PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01363g00033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 201aa    MW: 22431 Da    PI: 7.0453
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01363g00033.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR25.33e-0819441642
                       TCR 16 kYCeCfaagkkCseeCkCedCkNkeek 42
                               YCeCfa+g +C+  C+C++C N+ e+
  Peaxi162Scf01363g00033.1 19 VYCECFASGMYCDG-CNCDNCYNNVEN 44
                              5*************.********9875 PP

2TCR49.21.1e-1589127240
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               ++ gC+Ckks+ClkkYCeCf+ +k Cse+CkC dCkN e
  Peaxi162Scf01363g00033.1  89 NNTGCHCKKSSCLKKYCECFQTNKLCSENCKCMDCKNFE 127
                               6789*********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163428.5848128IPR005172CRC domain
SMARTSM011140.0231444IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.9E-51941IPR005172CRC domain
SMARTSM011146.5E-1588129IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.6E-1291126IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MYFQEETRIF KSSAKEKAVY CECFASGMYC DGCNCDNCYN NVENEPTRQE AIEVTLAHNP  60
NAFRPKISSP HEARDITGET GDGLLLAKNN TGCHCKKSSC LKKYCECFQT NKLCSENCKC  120
MDCKNFEGSE ERHVLFHGGH ANYHNMANAA IIEAIGSSGY GSPPSVRVKC PSSGRGDSSS  180
QNDRDPVNNE LERRFSRFFK S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280793.12e-72PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_009766311.12e-72PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
RefseqXP_009766313.18e-73PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X4
RefseqXP_010656305.12e-72PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_010656307.12e-72PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_016488500.14e-73PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
RefseqXP_016488501.13e-73PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SL701e-68TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A0V0IK563e-73A0A0V0IK56_SOLCH; Uncharacterized protein
STRINGVIT_11s0016g03680.t012e-72(Vitis vinifera)
STRINGPOPTR_0018s08960.17e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.13e-56Tesmin/TSO1-like CXC domain-containing protein